Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

GABA(A) receptor-associated protein-like 2, Mouse, Polyclonal Antibody, Abnova™

Mouse polyclonal antibody raised against a partial recombinant GABARAPL2.

Manufacturer:  Abnova Corporation H00011345A01

Catalog No. 89-004-544


Add to cart

Description

Description

Sequence: VIVEKVSGSQIVDIDKRKYLVPSDITVAQFMWIIRKRIQLPSEKAIFLFVDKTVPQSSLTMGQLYEKEKDEDGFLYVAYSGENTFGF
Specifications

Specifications

GABA(A) receptor-associated protein-like 2
Unconjugated
50% glycerol
NM_007285
ATG8|GATE-16|GATE16|GEF-2|GEF2
Mouse
50 uL
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Primary
11345
ELISA, Western Blot
Mouse polyclonal antibody raised against a partial recombinant GABARAPL2.
GABARAPL2
Serum
GABARAPL2
GABARAPL2 (NP_009216, 31 a.a. ~ 117 a.a) partial recombinant protein with GST tag.
RUO
Y
Polyclonal
Human
Documents
Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit