Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

anti-GDC, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

Manufacturer:  Novus BiologicalsSupplier Diversity Partner NBP191933

Catalog No. NBP191933


Add to cart

Description

Description

GDC Polyclonal antibody specifically detects GDC in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.
Specifications

Specifications

GDC
Unconjugated
PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
D10S105EGDC, GDASolute carrier family 25 member 16, Graves disease autoantigen, graves disease carrier protein, HGT.1, hML7, member 16, MGC39851, Mitochondrial solute carrier protein homolog, ML7, solute carrier family 25 (mitochondrial carrier; Graves disease autoantigen)
Rabbit
IgG
0.1 ml
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Polyclonal
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)
Western Blot 0.4 ug/ml, Immunohistochemistry, Immunohistochemistry-Paraffin 1:20 - 1:50
Affinity Purified
SLC25A16
This antibody was developed against Recombinant Protein corresponding to amino acids:RMQLGTVLPEFEKCLTMRDTMKYVYGHHGIRKGLY
Immunogen affinity purified
RUO
Primary
8034
Human
Documents
Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit

For Research Use Only