Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

Glutaminyl-peptide Cyclotransferase/QPCT Rabbit anti-Human, Mouse, Rat, Bovine, Canine, Equine, Guinea Pig, Rabbit, Sheep, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

Manufacturer:  Novus Biologicals NBP179295

Catalog No. NBP179295


Add to cart

Description

Description

Glutaminyl-peptide Cyclotransferase/QPCT Polyclonal antibody specifically detects Glutaminyl-peptide Cyclotransferase/QPCT in Human, Mouse, Rat, Bovine, Canine, Equine, Guinea Pig, Rabbit, Sheep samples. It is validated for Western Blot.
Specifications

Specifications

Glutaminyl-peptide Cyclotransferase/QPCT
Unconjugated
PBS and 2% Sucrose with 0.09% Sodium Azide
Affinity Purified
QPCT
Synthetic peptide directed towards the middle region of human QPCTThe immunogen for this antibody is QPCT. Peptide sequence SRHLAAKMASTPHPPGARGTSQLHGMDLLVLLDLIGAPNPTFPNFFPNSA.
38 kDa
100 ul
Store at -20C. Avoid freeze-thaw cycles.
Polyclonal
Expected identity based on immunogen sequence: Human: 100%; Guinea pig: 92%; Rabbit: 92%; Bovine: 85%; Pig: 85%; Sheep: 85%; Canine: 78%; Equine: 78%; Mouse: 78%; Rat: 78%.
Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Rabbit, Rat, Sheep
Western Blot
Western Blot 1:1000
NP_036545
EC 2.3.2.5, GCT, Glutaminyl cyclase, glutaminyl-peptide cyclotransferase, Glutaminyl-tRNA cyclotransferase, Glutamyl cyclase, QCEC, sQC
Rabbit
IgG
Immunogen affinity purified
RUO
Primary
25797
Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
SDS
Documents
Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit

For Research Use Only