Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

Glutathione Peroxidase 4/GPX4 Rabbit anti-Human, Mouse, Rat, Bovine, Guinea Pig, Goat, Yeast, Zebrafish, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

Manufacturer:  Novus Biologicals NBP154691

Catalog No. NBP154691


Add to cart

Description

Description

Glutathione Peroxidase 4/GPX4 Polyclonal antibody specifically detects Glutathione Peroxidase 4/GPX4 in Human, Mouse, Rat, Bovine, Guinea Pig, Goat, Yeast, Zebrafish samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin).
Specifications

Specifications

Glutathione Peroxidase 4/GPX4
Unconjugated
PBS and 2% Sucrose with 0.09% Sodium Azide
Affinity Purified
GPX4
Synthetic peptides corresponding to GPX4(glutathione peroxidase 4 (phospholipid hydroperoxidase)) The peptide sequence was selected from the middle region of GPX4. Peptide sequence QUGKTEVNYTQLVDLHARYAECGLRILAFPCNQFGKQEPGSNEEIKEFAA.
22 kDa
100 ul
Store at -20C. Avoid freeze-thaw cycles.
Polyclonal
Pig: 86%; .
Bovine, Goat, Guinea Pig, Human, Mouse, Rat, Yeast, Zebrafish
Immunohistochemistry, Immunohistochemistry (Paraffin), Western Blot
Western Blot 1:100-1:2000, Immunohistochemistry 1:10-1:500, Immunohistochemistry-Paraffin 1:10-1:500
P36969
EC 1.11.1, EC 1.11.1.12, Glutathione peroxidase 4, glutathione peroxidase 4 (phospholipid hydroperoxidase), GPx-4, GSHPx-4, MCSP, PHGPxsnGPx, phospholipid hydroperoxidase, phospholipid hydroperoxide glutathione peroxidase, mitochondrial, snPHGPx, sperm nucleus glutathione peroxidase
Rabbit
IgG
Immunogen affinity purified
RUO
Primary
2879
Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
Documents
Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit

For Research Use Only