Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

anti-GOLGB1/Giantin, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

Manufacturer:  Novus BiologicalsSupplier Diversity Partner NBP191938

Catalog No. NBP191938


Add to cart

Description

Description

GOLGB1/Giantin Polyclonal antibody specifically detects GOLGB1/Giantin in Human samples. It is validated for Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin.
Specifications

Specifications

GOLGB1/Giantin
Unconjugated
PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
372 kDa Golgi complex-associated protein, GCP, GCP372GIANTIN, giantin, golgi autoantigen, golgin subfamily b, macrogolgin (with transmembrane signal)1,macrogolgin, golgi integral membrane protein 1, golgin B1, golgin B1, golgi integral membrane protein, Golgin subfamily B member 1, GOLIM1, Macrogolgin
Rabbit
IgG
0.1 ml
Golgi Apparatus Markers
Primary
2804
Human
Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin)
Immunohistochemistry 1:10-1:500, Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml, Immunohistochemistry-Paraffin 1:200-1:500
Affinity Purified
GOLGB1
This antibody was developed against Recombinant Protein corresponding to amino acids:RLSGLANVVLHELSGDDDTDQNMRAPLDPELHQESDMEFNNTTQEDVQERLAYAEQLVVELKDIIRQKDVQLQQKDEALQEERKAADNKIKKLKLHAKAKLTSLNKYIEEMKAQGGTVLPTEPQSEEQLSKHD
Immunogen affinity purified
RUO
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Polyclonal
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Documents
Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit

For Research Use Only