Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

GRHL3 Rabbit anti-Human, Mouse, Rat, Bovine, Canine, Equine, Guinea Pig, Rabbit, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

Manufacturer:  Novus Biologicals NBP180018

Catalog No. NBP180018


Add to cart

Description

Description

GRHL3 Polyclonal antibody specifically detects GRHL3 in Human, Mouse, Rat, Bovine, Canine, Equine, Guinea Pig, Rabbit samples. It is validated for Western Blot, Immunohistochemistry, ChIP assay.
Specifications

Specifications

GRHL3
Unconjugated
PBS & 2% Sucrose. with 0.09% Sodium Azide
Affinity Purified
GRHL3
Synthetic peptide directed towards the C terminal of human GRHL3. Peptide sequence SGVKGCLLSGFRGNETTYLRPETDLETPPVLFIPNVHFSSLQRSGGAAPS.
57 kDa
100 ul
Store at -20C. Avoid freeze-thaw cycles.
Polyclonal
Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
ChIP assay, Immunohistochemistry, Western Blot
Western Blot 1:1000, Immunohistochemistry, Chromatin Immunoprecipitation (ChIP)
NP_937817
grainyhead-like 3 (Drosophila), MGC46624, Sister of mammalian grainyhead, sister-of-mammalian grainyhead, SOMTranscription factor CP2-like 4grainyhead-like protein 3 homolog, TFCP2L4, transcription factor hSOM1
Rabbit
IgG
Immunogen affinity purified
RUO
Primary
57822
Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Rabbit, Rat
Documents
Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit

For Research Use Only