Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

GSTT1 Rabbit anti-Human, Rat, Bovine, Canine, Equine, Guinea Pig, Rabbit, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

Manufacturer:  Novus Biologicals NBP153049

Catalog No. NBP153049


Add to cart

Description

Description

GSTT1 Polyclonal antibody specifically detects GSTT1 in Human, Rat, Bovine, Canine, Equine, Guinea Pig, Rabbit samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin).
Specifications

Specifications

GSTT1
Unconjugated
PBS and 2% Sucrose with 0.09% Sodium Azide
Affinity Purified
GSTT1
Synthetic peptides corresponding to GSTT1(glutathione S-transferase theta 1) The peptide sequence was selected from the C terminal of GSTT1. Peptide sequence TWRQRVEAAVGEDLFQEAHEVILKAKDFPPADPTIKQKLMPWVLAMIR.
Immunogen affinity purified
RUO
Store at -20C. Avoid freeze-thaw cycles.
Polyclonal
Expected identity based on immunogen sequence: Human: 100%; Canine: 85%; Bovine: 78%; Guinea pig: 78%; Rabbit: 78%.
Bovine, Canine, Equine, Guinea Pig, Human, Rabbit, Rat
Immunohistochemistry, Immunohistochemistry (Paraffin), Western Blot
Western Blot 1:100-1:2000, Immunohistochemistry 1:10-1:500, Immunohistochemistry-Paraffin 1:10-1:500
P30711
EC 2.5.1.18, glutathione S-transferase theta 1, glutathione S-transferase theta-1, Glutathione transferase T1-1, GST class-theta-1
Rabbit
IgG
100 ul
Asthma, Cancer, Immunology
Primary
2952
Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
Documents
Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit

For Research Use Only