Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
GTF2IRD1 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody has been used in 3 publications
Supplier: Novus Biologicals NBP191973
Description
GTF2IRD1 Polyclonal specifically detects GTF2IRD1 in Human, Mouse samples. It is validated for Western Blot, Chromatin Immunoprecipitation, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin, Knockout Validated.Specifications
GTF2IRD1 | |
Polyclonal | |
Western Blot 0.04-0.4 ug/ml, Immunohistochemistry 1:500 - 1:1000, Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml, Immunohistochemistry-Paraffin 1:500 - 1:1000, Chromatin Immunoprecipitation (ChIP), Knockout Validated | |
BEN, CREAM1, General transcription factor III, general transcription factor II-I repeat domain-containing protein 1, GTF2I repeat domain containing 1, GTF2I repeat domain-containing protein 1, GTF3GTF2I repeat domain-containing 1, hMusTRD1alpha1, Muscle TFII-I repeat domain-containing protein 1, muscle TFII-I repeat domain-containing protein 1 alpha 1, MusTRD1, MusTRD1/BEN, MUSTRD1general transcription factor 3, RBAP2WBSCR12binding factor for early enhancer, Slow-muscle-fiber enhancer-binding protein, USE B1-binding protein, WBS, WBSCR11, Williams-Beuren syndrome chromosomal region 11 protein, Williams-Beuren syndrome chromosomal region 12 protein, Williams-Beuren syndrome chromosome region 11 | |
Rabbit | |
Affinity Purified | |
RUO | |
9569 | |
Human, Mouse | |
IgG |
Western Blot, Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin), Immunohistochemistry (Paraffin) | |
Unconjugated | |
PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide | |
GTF2IRD1 | |
This antibody was developed against Recombinant Protein corresponding to amino acids:RPCTYGVPKLKRILEERHSIHFIIKRMFDERIFTGNKFTKDTTKLEPASPPEDTSAEVSRATVLDLAGNARSDKGSMSEDCGPGTSGELGGLRPIKIEPEDLDIIQVTVPDPSPTSEEMTDSMPGHLPSEDSGYGMEMLTD | |
0.1 mL | |
Primary | |
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. | |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title
For Research Use Only
Spot an opportunity for improvement?
Provide Content Correction