Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

glycophorin C (Gerbich blood group), Mouse, Polyclonal Antibody, Abnova™

Mouse polyclonal antibody raised against a full-length human GYPC protein.

Manufacturer:  Abnova Corporation H00002995B01

Catalog No. 89-005-496


Add to cart

Description

Description

Glycophorin C (GYPC) is an integral membrane glycoprotein. It is a minor species carried by human erythrocytes, but plays an important role in regulating the mechanical stability of red cells. A number of glycophorin C mutations have been described. The Gerbich and Yus phenotypes are due to deletion of exon 3 and 2, respectively. The Webb and Duch antigens, also known as glycophorin D, result from single point mutations of the glycophorin C gene. The glycophorin C protein has very little homology with glycophorins A and B. [provided by RefSeq

Sequence: MWSTRSPNSTAWPLSLEPDPGMASASTTMHTTTIAEPDPGMSGWPDGRMETSTPTIMDIVVIAGVIAAVAIVLVSLLFVMLRYMYRHKGTYHTNEAKGTEFAESADAALQGDPALQDAGDSSRKEYFI
Specifications

Specifications

glycophorin C (Gerbich blood group)
Unconjugated
No additive
NM_002101.3
CD236|CD236R|GE|GPC|GYPD|MGC117309|MGC126191|MGC126192
Mouse
50 uL
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Primary
2995
Western Blot
Mouse polyclonal antibody raised against a full-length human GYPC protein.
GYPC
Serum
GYPC
GYPC (NP_002092.1, 1 a.a. ~ 128 a.a) full-length human protein.
RUO
Y
Polyclonal
Human
Documents
Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit