Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

heme binding protein 1, Mouse, Purified MaxPab™ Polyclonal Antibody, Abnova™

Mouse polyclonal antibody raised against a full-length human HEBP1 protein.

Manufacturer:  Abnova Corporation H00050865B01P

Catalog No. 89-017-072


  Check Availability
Add to cart

Specifications

Description

The full-length protein encoded by this gene is an intracellular tetrapyrrole-binding protein. This protein includes a natural chemoattractant peptide of 21 amino acids at the N-terminus, which is a natural ligand for formyl peptide receptor-like receptor 2 (FPRL2) and promotes calcium mobilization and chemotaxis in monocytes and dendritic cells. [provided by RefSeq

Sequence: MLGMIKNSLFGSVETWPWQVLSKGDKEEVAYEERACEGGKFATVEVTDKPVDEALREAMPKVAKYAGGTNDKGIGMGMTVPISFAVFPNEDGSLQKKLKVWFRIPNQFQSDPPAPSDKSVKIEEREGITVYSMQFGGYAKEADYVAQATRLRAALEGTATYRGDIYFCTGYDPPMKPYGRRNEIWLLKT
Description & Specifications

Specifications

heme binding protein 1
Unlabeled
In 1X PBS, pH 7.4
BC016277
HBP, HEBP
Murine
Protein A column
RUO
Primary
50865
Western Blot
heme binding protein 1
HEBP1
Affinity Purified
HEBP1
HEBP1 (AAH16277, 1 a.a. ∽189 a.a) full-length human protein.
50μg
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Polyclonal
Human
Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit