Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

Heterogeneous Nuclear Ribonucleoprotein (A1-like) Rabbit anti-Human, Mouse, Rat, Porcine, Bovine, Canine, Equine, Guinea Pig, Rabbit, Zebrafish, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

Manufacturer:  Novus Biologicals NBP180446

Catalog No. NBP180446


Add to cart

Description

Description

Heterogeneous Nuclear Ribonucleoprotein (A1-like) Polyclonal antibody specifically detects Heterogeneous Nuclear Ribonucleoprotein (A1-like) in Human, Mouse, Rat, Porcine, Bovine, Canine, Equine, Guinea Pig, Rabbit, Zebrafish samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin).
Specifications

Specifications

Heterogeneous Nuclear Ribonucleoprotein (A1-like)
Unconjugated
PBS and 2% Sucrose with 0.09% Sodium Azide
Affinity Purified
HNRNPA1L2
Synthetic peptide directed towards the N terminal of human RP11-78J21. 1. Peptide sequence MSKSASPKEPEQLRKLFIGGLSFETTDESLRSHFEQWGTLTDCVVMRDPN.
Immunogen affinity purified
RUO
Primary
144983
Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
Immunohistochemistry, Immunohistochemistry (Paraffin), Western Blot
Western Blot 1:1000, Immunohistochemistry 1:10-1:500, Immunohistochemistry-Paraffin 1:10-1:500
NP_001011724
heterogeneous nuclear ribonucleoprotein A1-like 2, hnRNP A1-like 2, hnRNP core protein A1-like 2, HNRNPA1L, LOC144983, MGC102957
Rabbit
IgG
100 ul
Store at -20C. Avoid freeze-thaw cycles.
Polyclonal
Expected identity based on immunogen sequence: Chimpanzee: 100%; Equine: 100%; Chicken: 100%; Crab-eating macaque: 100%; Rhesus macaque: 100%; Pig: 100%; Mouse: 100%; Canine: 100%; Bovine: 100%; Rat: 100%; Zebrafish: 92%; Western clawed frog: 92%; Green puffer: 92%; Japanese pufferfish: 92%; Xenopus: 92%; Atlantic salmon: 92%; Burton's mouthbrooder: 92%; Greater Equineshoe bat: 85%; Human: 100%; Sumatran orangutan: 84%; American grasshopper: 83%; Body louse: 81%; Rainbow trout: 76%; Fission yeast: 76%.
Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Porcine, Rabbit, Rat, Zebrafish
Documents
Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit

For Research Use Only