hedgehog interacting protein, Mouse, Clone: 5D11, Abnova™

Mouse monoclonal antibody raised against a partial recombinant HHIP.

Supplier:  Abnova Corporation H00064399M01

Catalog No. 89-014-330

Description

This gene encodes a protein similar to the mouse hedgehog-interacting protein, a regulatory component of the hedgehog signalling pathway. Members of the hedgehog family are evolutionarily conserved proteins which are involved in many fundamental processes in embryonic development, including anteroposterior patterns of limbs and regulation of left-right asymmetry. [provided by RefSeq

Sequence: GDAKFGERNEGSGARRRRCLNGNPPKRLKRRDRRMMSQLELLSGGEMLCGGFYPRLSCCLRSDSPGLGRLENKIFSVTNNTECGKLLEEIKCALCSPHSQ

Specifications

• Antigen: hedgehog interacting protein
• Classification: Monoclonal
• Conjugate: Unconjugated
• Formulation: PBS with no preservative; pH 7.4
• Gene Accession No.: NM_022475
• Gene Symbols: HHIP
• Immunogen: HHIP (NP_071920, 21 a.a. ∼ 120 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Quantity: 100 μg
• Primary or Secondary: Primary
• Target Species: Human
• Product Type: Antibody

• Applications: ELISA, Immunohistochemistry (PFA fixed), Immunoprecipitation, Western Blot
• Clone: 5D11
• Description: Mouse monoclonal antibody raised against a partial recombinant HHIP.
• Gene: HHIP
• Gene Alias: FLJ20992/FLJ90230/HIP/STQTL12
• Host Species: Mouse
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Gene ID (Entrez): 64399
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Isotype: IgG2b κ