anti-HLA DQB1, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

Manufacturer:  Novus Biologicals NBP184549

Catalog No. NBP184549

Description

HLA DQB1 Polyclonal antibody specifically detects HLA DQB1 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.

Specifications

• Antigen: HLA DQB1
• Conjugate: Unconjugated
• Formulation: PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
• Gene Alias: DC-1 alpha chain, DC-alpha, HLA class II histocompatibility antigen, DQ alpha 1 chain-like, HLA-DCA, MHC class II DQA1
• Host Species: Rabbit
• Isotype: IgG
• Quantity: 0.1 ml
• Research Discipline: Asthma, Diabetes Research, Immunology
• Primary or Secondary: Primary
• Gene ID (Entrez): 3119
• Target Species: Human

• Applications: Immunohistochemistry, Immunohistochemistry (Paraffin), Western Blot
• Dilution: Western Blot 0.4 ug/ml, Immunohistochemistry, Immunohistochemistry-Paraffin 1:50 - 1:200
• Format: Affinity Purified
• Gene Symbols: HLA-DQB1
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids:RPDAEYWNSQKEVLEGTRAELDTVCRHNYEVAFRGILQRRVEPTVTISPSRTEALNHHNLLVCSVT
• Purification Method: Immunogen affinity purified
• Regulatory Status: RUO
• Storage Requirements: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Monoclonal or Polyclonal: Polyclonal
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.

For Research Use Only