Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

anti-HNF-4 alpha/NR2A1, Polyclonal, Novus Biologicals™

Manufacturer:  Novus Biologicals NBP152912

Catalog No. NBP152912

This item has been discontinued by the manufacturer and is no longer available. Please call customer service for assistance: 1-800-766-7000.


Specifications

Specifications

HNF-4 alpha/NR2A1
Unconjugated
PBS and 2% Sucrose with 0.09% Sodium Azide
Affinity Purified
HNF4A
Synthetic peptides corresponding to HNF4A(hepatocyte nuclear factor 4, alpha) The peptide sequence was selected from the middle region of HNF4A (NP_001025174). Peptide sequence LPFQELQIDDNEYAYLKAIIFFDPDAKGLSDPGKIKRLRSQVQVSLEDYI.
49 kDa
100 ul
Stem Cell Markers
Primary
3172
Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
Western Blot
Western Blot 0.2-1 ug/ml
P41235
FLJ39654, hepatic nuclear factor 4 alpha, hepatocyte nuclear factor 4, alpha, hepatocyte nuclear factor 4-alpha, HNF4a7, HNF-4-alpha, HNF4alpha10/11/12, HNF4HNF4a8, MODY, MODY1, NR2A1HNF4a9, NR2A21, Nuclear receptor subfamily 2 group A member 1, TCF, TCF-14, TCF14HNF4alpha, Transcription factor 14, Transcription factor HNF-4, transcription factor-14
Rabbit
IgG
Immunogen affinity purified
RUO
Store at -20C. Avoid freeze-thaw cycles.
Polyclonal
Expected identity based on immunogen sequence: Bovine: 100%; Canine: 100%; Equine: 100%; Human: 100%; Mouse: 100%; Pig: 100%; Rabbit: 100%; Rat: 100%; Sheep: 100%; Xenopus: 92%; Chicken: 92%; Zebrafish: 92%.
Human
Documents
Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit

For Research Use Only