Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

HOP homeobox, Mouse, Polyclonal Antibody, Abnova™

Mouse polyclonal antibody raised against a full-length human HOP protein.

Manufacturer:  Abnova Corporation H00084525B02

Catalog No. 89-008-344


Add to cart

Description

Description

The protein encoded by this gene is a homeodomain protein that lacks certain conserved residues required for DNA binding. It was reported that choriocarcinoma cell lines and tissues failed to express this gene, which suggested the possible involvement of this gene in malignant conversion of placental trophoblasts. Studies in mice suggest that this protein may interact with serum response factor (SRF) and modulate SRF-dependent cardiac-specific gene expression and cardiac development. Multiple alternatively spliced transcript variants have been identified for this gene. [provided by RefSeq

Sequence: MSAETASGPTEDQVEILEYNFNKVDKHPDSTTLCLIAAEAGLSEEETQKWFKQRLAKWRRSEGLPSECRSVID
Specifications

Specifications

HOP homeobox
Unconjugated
No additive
BC014225.2
Cameo|HOP|LAGY|MGC20820|NECC1|OB1|SMAP31|Toto
Mouse
50 uL
Transcription Regulation
Y
Polyclonal
Human
Western Blot
Mouse polyclonal antibody raised against a full-length human HOP protein.
HOPX
Serum
HOPX
HOP (AAH14225.1, 1 a.a. ~ 73 a.a) full-length human protein.
RUO
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Primary
84525
SDS
Documents
Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit