Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

anti-HSP90 beta, Polyclonal, Novus Biologicals™

Manufacturer:  Novus Biologicals NBP179942

Catalog No. NBP179942

This item has been discontinued by the manufacturer and is no longer available. Please call customer service for assistance: 1-800-766-7000.


Specifications

Specifications

HSP90 beta
Unconjugated
PBS and 2% Sucrose with 0.09% Sodium Azide
Purified
HSP90AB1
Synthetic peptide directed towards the N terminal of human HSP90AB1. Peptide sequence MPEEVHHGEEEVETFAFQAEIAQLMSLIINTFYSNKEIFLRELISNASDA.
83 kDa
100ul
Store at -20C. Avoid freeze-thaw cycles.
Polyclonal
Expected identity based on immunogen sequence Xenopus: 78%; Chicken: 78% African clawed frog: 78%.
Human
Immunohistochemistry, Western Blot
Western Blot 1:1000, Immunohistochemistry
NP_031381
Heat shock 84 kDa, heat shock 90kD protein 1, beta, heat shock 90kDa protein 1, beta, heat shock protein 90kDa alpha (cytosolic), class B member 1, heat shock protein beta, heat shock protein HSP 90-beta, HSP 84, HSP84, HSP90-BETA, HSP90BHSP 90, HSPC2D6S182, HSPCBFLJ26984
Rabbit
IgG
Protein A purified
RUO
Primary
3326
Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 100μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
Documents
Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit

For Research Use Only