heat shock 70kDa protein 1-like, Mouse, Polyclonal Antibody, Abnova™

Mouse polyclonal antibody raised against a partial recombinant HSPA1L.

Manufacturer:  Abnova Corporation H00003305A01

Catalog No. 89-004-158

Description

This gene encodes a 70kDa heat shock protein. In conjunction with other heat shock proteins, this protein stabilizes existing proteins against aggregation and mediates the folding of newly translated proteins in the cytosol and in organelles. The gene is located in the major histocompatibility complex class III region, in a cluster with two closely related genes which also encode isoforms of the 70kDa heat shock protein. [provided by RefSeq

Sequence: KGKISESDKNKILDKCNELLSWLEVNQLAEKDEFDHKRKELEQMCNPIITKLYQGGCTGPACGTGYVPGRPATGPTIEEVD

Specifications

• Antigen: heat shock 70kDa protein 1-like
• Conjugate: Unconjugated
• Formulation: 50% glycerol
• Gene Accession No.: NM_005527
• Gene Alias: HSP70-1L|HSP70-HOM|HSP70T|hum70t
• Host Species: Mouse
• Quantity: 50 uL
• Storage Requirements: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Primary or Secondary: Primary
• Gene ID (Entrez): 3305

• Applications: ELISA, Western Blot
• Description: Mouse polyclonal antibody raised against a partial recombinant HSPA1L.
• Gene: HSPA1L
• Format: Serum
• Gene Symbols: HSPA1L
• Immunogen: HSPA1L (NP_005518, 561 a.a. ~ 641 a.a) partial recombinant protein with GST tag.
• Regulatory Status: RUO
• Whole Molecule: Y
• Monoclonal or Polyclonal: Polyclonal
• Target Species: Human