hormonally up-regulated Neu-associated kinase, Mouse, Clone: 2G3, Abnova™

Mouse monoclonal antibody raised against a partial recombinant HUNK.

Supplier:  Abnova Corporation H00030811M03

Catalog No. 89-001-267

Description

Sequence: LHPTLVSFAHEDKNSPPKEEGLCCPPPVPSNGPMQPLGSPNCVKSRGRFPMMGIGQMLRKRHQSLQPSADRPLEASLPPLQPLAPVNLAFDMADGVKTQC

Specifications

• Antigen: hormonally up-regulated Neu-associated kinase
• Classification: Monoclonal
• Conjugate: Unconjugated
• Formulation: PBS with no preservative; pH 7.4
• Gene Accession No.: NM_014586
• Host Species: Mouse
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Whole Molecule: Yes
• Gene ID (Entrez): 30811
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Isotype: IgG2a κ

• Applications: ELISA, Western Blot
• Clone: 2G3
• Description: Mouse monoclonal antibody raised against a partial recombinant HUNK.
• Gene: HUNK
• Gene Symbols: HUNK
• Immunogen: HUNK (NP_055401, 615 a.a. ∼ 714 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Quantity: 100 μg
• Research Discipline: Kinases
• Primary or Secondary: Primary
• Target Species: Human
• Product Type: Antibody