Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

insulin-degrading enzyme, Mouse, Polyclonal Antibody, Abnova™

Mouse polyclonal antibody raised against a partial recombinant IDE.

Manufacturer:  Abnova Corporation H00003416A01

Catalog No. 89-004-163


Add to cart

Description

Description

This gene may belong to a protease family responsible for intercellular peptide signalling. Though its role in the cellular processing of insulin has not yet been defined, insulin-degrading enzyme is thought to be involved in the termination of the insulin response. [provided by RefSeq

Sequence: RDNTEVAYLKTLTKEDIIKFYKEMLAVDAPRRHKVSVHVLAREMDSCPVVGEFPCQNDINLSQAPALPQPEVIQNMTEFKRGLPLFPLVKPHINFMAAKL
Specifications

Specifications

insulin-degrading enzyme
Unconjugated
50% glycerol
NM_004969
FLJ35968|INSULYSIN
Mouse
50 uL
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Primary
3416
ELISA, Western Blot
Mouse polyclonal antibody raised against a partial recombinant IDE.
IDE
Serum
IDE
IDE (NP_004960, 920 a.a. ~ 1019 a.a) partial recombinant protein with GST tag.
RUO
Y
Polyclonal
Human, Rat
Documents
Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit