Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

anti-IKK epsilon/IKBKE, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

Manufacturer:  Novus Biologicals NBP183114

Catalog No. NBP183114


Add to cart

Description

Description

IKK epsilon/IKBKE Polyclonal antibody specifically detects IKK epsilon/IKBKE in Human, Mouse samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.
Specifications

Specifications

IKK epsilon/IKBKE
Unconjugated
PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
EC 2.7.11, EC 2.7.11.10, I-kappa-B kinase epsilon, IkBKE, IKK-E, IKKEMGC125297, IKK-epsilon, IKKI, IKK-iMGC125295, Inducible I kappa-B kinase, inducible IkappaB kinase, inhibitor of kappa light polypeptide gene enhancer in B-cells, kinase epsilon, inhibitor of nuclear factor kappa-B kinase subunit epsilon, KIAA0151IKK-related kinase epsilon, MGC125294
Rabbit
IgG
0.1 ml
Cancer, Protein Kinase
Primary
9641
Human, Mouse
Immunohistochemistry, Immunohistochemistry (Paraffin), Western Blot
Western Blot 0.04-0.4 μg/mL, Immunohistochemistry 1:50 - 1:200, Immunohistochemistry-Paraffin 1:50 - 1:200
Affinity Purified
IKBKE
This antibody was developed against Recombinant Protein corresponding to amino acids:IHKLDKVNFSHLAKRLLQVFQEECVQKYQASLVTHGKRMRVVHETRNHLRLVGCSVAACNTEAQGVQESLSKLLEELSHQLLQDRAKGAQASPPPIAPYPSPTRKDLLLHMQELCEGMKLLASDLLDNNRIIERLN
Immunogen affinity purified
RUO
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Polyclonal
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
SDS
Documents
Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit

For Research Use Only