Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

anti-IL-21, Polyclonal, Novus Biologicals™

Manufacturer:  Novus Biologicals NBP130074

Catalog No. NBP130074

This item has been discontinued by the manufacturer and is no longer available. Please call customer service for assistance: 1-800-766-7000.


Specifications

Specifications

IL-21
1.0 mg/mL
ELISA 1:50000, Immunohistochemistry 1:250, Immunohistochemistry-Paraffin 1:250
Q9HBE4
IL-21Za11interleukin-21, interleukin 21, interleukin-21 isoform
Goat
IgG
0.1 mg
Cytokine Research, Immunology, Innate Immunity, Signal Transduction
Primary
59067
Human
ELISA, Immunohistochemistry, Immunohistochemistry (Paraffin)
Unconjugated
10mM KHPO4 and 0.14M NaCl with 0.1% Sodium Azide
Affinity Purified
IL21
Synthetic peptide 78 CFQKAQLKSANTGNNERIINVSIKKLKRKPPS 109 corresponding to N-terminus region of human IL-21
Immunogen affinity purified
RUO
Store at -20C. Avoid freeze-thaw cycles.
Polyclonal
human IL-21
Documents
Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit

For Research Use Only