Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

IL-21 Goat anti-Mouse, Polyclonal, Invitrogen™

Goat Polyclonal Antibody

Manufacturer:  Invitrogen PA121355

Catalog No. PA121355

Add to cart



PA1-21355 detects IL-21 in Mouse samples. PA1-21355 has been successfully used in ELISA and Immunohistochemistry (paraffin) procedures. PA1-21355 immunogen corresponds to Synthetic peptide of Mouse IL21 N terminal amino acids 32-61 [CRHLIDIVEQLKIYENDLDPELLSAPQDVK].

IL-21 is a 17 kDa immunomodulatory cytokine produced mainly by Natural Killer Cells (NKT), T helper (Th) 17 and T follicular helper (TFH) cells. In TFH cells, IL-21 expression leads to autocrine signaling through the IL-21 receptor (IL-21R) and STAT3, which leads to additional transcriptional activation by Bcl6. As with IFN gamma for Th1 and IL-4 for Th2 cells, IL-21 is critical for TFH cell development and effector function. IL-21 plays a role in T cell-dependent B cell differentiation into plasma cells and memory cells, stimulation of IgG production and induction of apoptotic signaling in naive B cells. In Th17 cells, IL-21 expression and autocrine feedback through STAT3, IRF4 and ROR gamma t lead to upregulation of the IL-23R, thereby preparing Th17 cells for maturation and maintece by the inflammatory cytokine IL-23. While upregulating IRF4 and ROR gamma t, IL-21 also mediates the downregulation of Foxp3. IL-21 deficient mice are protected from developing colitis upon chemical treatment by their inability to upregulate Th17-associated molecules. In comparison, elevated levels of IL-21 are present in chemically-induced colitis mouse models.


Synthetic peptide of Mouse IL21 N terminal amino acids 32-61 [CRHLIDIVEQLKIYENDLDPELLSAPQDVK]
Antigen affinity chromatography
ELISA, Immunohistochemistry (Paraffin)
1.0 mg/mL
0.01M potassium phosphate with 0.14M NaCl and 0.1% sodium azide
Interleukin-21, IL-21, Za11
50 μg
Store at 4°C short term. For long term storage, store at -20°C, avoiding freeze/thaw cycles.
Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit