Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

interleukin 2 receptor, gamma (severe combined immunodeficiency), Mouse, Polyclonal Antibody, Abnova™

Mouse polyclonal antibody raised against a full-length human IL2RG protein.

Manufacturer:  Abnova Corporation H00003561B01

Catalog No. 89-005-621


Add to cart

Description

Description

The interleukin 2 (IL2) receptor gamma chain (IL2RG), an important signalling component of many interleukin receptors (IL2,IL4,IL7,IL9, and IL15), is thus referred to as the common gamma chain. Mutations in this X-chromosome-linked gene cause X-linked severe combined immunodeficiency (XSCID). [provided by RefSeq

Sequence: MLKPSLPFTSLLFLQLPLLGVGLNTTILTPNGNEDTTADFFLTTMPTDSLSVSTLPLPEVQCFVFNVEYMNCTWNSSSEPQPTNLTLHYWYKNSDNDKVQKCSHYLFSEEITSGCQLQKKEIHLYQTFVVQLQDPREPRRQATQMLKLQNLVIPWAPENLTLHKLSESQLELNWNNRFLNHCLEHLVQYRTDWDHSWTEQSVDYRHKFSLPSVDGQKRYTFRVRSRFNPLCGSAQHWSEWSHPIHWGSNTSKENPFLFALEAVVISVGSMGLIISLLCVYFWLERTMPRIPTLKNLEDLVTEYHGNFSAWSGVSKGLAESLQPDYSERLCLVSEIPPKGGALGEGPGASPCNQHSPYWAPPCYTLKPET
Specifications

Specifications

interleukin 2 receptor, gamma (severe combined immunodeficiency)
Unconjugated
No additive
NM_000206.1
CD132|IMD4|SCIDX|SCIDX1
Mouse
50 uL
Membrane Receptors
Y
Polyclonal
Human
Western Blot
Mouse polyclonal antibody raised against a full-length human IL2RG protein.
IL2RG
Serum
IL2RG
IL2RG (NP_000197.1, 1 a.a. ~ 369 a.a) full-length human protein.
RUO
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Primary
3561
Documents
Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit