IL32, Mouse, Polyclonal Antibody, Abnova™

Mouse polyclonal antibody raised against a full-length human IL32 protein.

Manufacturer:  Abnova Corporation H00009235B01

Catalog No. 89-006-733

Description

This gene encodes a member of the cytokine family. The protein contains a tyrosine sulfation site, 3 potential N-myristoylation sites, multiple putative phosphorylation sites, and an RGD cell-attachment sequence. Expression of this protein is increased after the activation of T-cells by mitogens or the activation of NK cells by IL-2. This protein induces the production of TNFalpha from macrophage cells. Alternate transcriptional splice variants, encoding different isoforms, have been characterized. [provided by RefSeq

Sequence: MCFPKVLSDDMKKLKARMHQAIERFYDKMQNAESGRGQVMSSLAELEDDFKEGYLETVAAYYEEQHPELTPLLEKERDGLRCRGNRSPVPDVEDPATEEPGESFCDKVMRWFQAMLQRLQTWWHGVLAWVKEKVVALVHAVQALWKQFQSFCCSLSELFMSSFQSYGAPRGDKEELTPQKCSEPQSSK

Specifications

• Antigen: IL32
• Conjugate: Unconjugated
• Formulation: No additive
• Gene Accession No.: NM_001012631.1
• Gene Alias: IL-32alpha|IL-32beta|IL-32delta|IL-32gamma|NK4|TAIF|TAIFa|TAIFb|TAIFc|TAIFd
• Host Species: Mouse
• Quantity: 50 uL
• Storage Requirements: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Primary or Secondary: Primary
• Gene ID (Entrez): 9235

• Applications: Western Blot
• Description: Mouse polyclonal antibody raised against a full-length human IL32 protein.
• Gene: IL32
• Format: Serum
• Gene Symbols: IL32
• Immunogen: IL32 (NP_001012649.1, 1 a.a. ~ 188 a.a) full-length human protein.
• Regulatory Status: RUO
• Whole Molecule: Y
• Monoclonal or Polyclonal: Polyclonal
• Target Species: Human