Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

IL8, Mouse, Clone: 4E3, Abnova™

Mouse monoclonal antibody raised against a full-length recombinant IL8.

Manufacturer:  Abnova Corporation H00003576M18

Catalog No. 89-123-190


Add to cart

Description

Description

The protein encoded by this gene is a member of the CXC chemokine family. This chemokine is one of the major mediators of the inflammatory response. This chemokine is secreted by several cell types. It functions as a chemoattractant, and is also a potent angiogenic factor. This gene is believed to play a role in the pathogenesis of bronchiolitis, a common respiratory tract disease caused by viral infection. This gene and other ten members of the CXC chemokine gene family form a chemokine gene cluster in a region mapped to chromosome 4q. [provided by RefSeq

Sequence: EGAVLPRSAKELRCQCIKTYSKPFHPKFIKELRVIESGPHCANTEIIVKLSDGRELCLDPKENWVQRVVEKFLKRAENS
Specifications

Specifications

IL8
Monoclonal
Unconjugated
PBS with no preservative; pH 7.4
BC013615
CXCL8|GCP-1|GCP1|LECT|LUCT|LYNAP|MDNCF|MONAP|NAF|NAP-1|NAP1
Mouse
IgG2b Kappa
100 ug
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Primary
3576
ELISA, Immunoprecipitation, Western Blot
4E3
Mouse monoclonal antibody raised against a full length recombinant IL8.
IL8
Liquid
IL8
IL8 (AAH13615, 21 a.a. ~ 99 a.a) full length recombinant protein.
Affinity chromatography
RUO
Antibody
Monoclonal
Human
Documents
Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit