integrin-linked kinase-associated serine/threonine phosphatase 2C (A01), Mouse anti-Human, Polyclonal Antibody, Abnova™

Mouse polyclonal antibody raised against a partial recombinant ILKAP.

Supplier:  Abnova Corporation H00080895A01

Catalog No. 89-004-730

Description

The protein encoded by this gene is a protein serine/threonine phosphatase of the PP2C family. This protein can interact with integrin-linked kinase (ILK/ILK1), a regulator of integrin mediated signaling, and regulate the kinase activity of ILK. Through the interaction with ILK, this protein may selectively affect the signaling process of ILK-mediated glycogen synthase kinase 3 beta (GSK3beta), and thus participate in Wnt signaling pathway. [provided by RefSeq

Sequence: IGDGQYKRCGVTSVPDIRRCQLTPNDRFILLACDGLFKVFTPEEAVNFILSCLEDEKIQTREGKSAADARYEAACNRLANKAVQRGSADNVTVMVVRIGH

Specifications

• Antigen: integrin-linked kinase-associated serine/threonine phosphatase 2C
• Classification: Polyclonal
• Description: Mouse polyclonal antibody raised against a partial recombinant ILKAP.
• Gene: ILKAP
• Gene Alias: DKFZp434J2031/FLJ10181/MGC4846/PP2C-DELTA
• Host Species: Mouse
• Quantity: 50 μL
• Research Discipline: Signal Transduction
• Primary or Secondary: Primary
• Target Species: Human
• Form: Serum

• Applications: ELISA, Western Blot
• Conjugate: Unconjugated
• Formulation: 50% glycerol
• Gene Accession No.: NM_030768
• Gene Symbols: ILKAP
• Immunogen: ILKAP (NP_110395, 293 a.a. ∼ 392 a.a) partial recombinant protein with GST tag.
• Regulatory Status: RUO
• Whole Molecule: Yes
• Gene ID (Entrez): 80895
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.