Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

integrin beta 1 binding protein (melusin) 2 (A01), Mouse anti-Human, Polyclonal Antibody, Abnova™

Mouse polyclonal antibody raised against a partial recombinant ITGB1BP2.

Manufacturer:  Abnova Corporation H00026548A01

Catalog No. 89-004-590


Add to cart

Description

Description

Sequence: KASQTELHVHIVFDGNRVFQAQMKLWGVINVEQSSVFLMPSRVEISLVKADPGSWAQLEHPDALAKKARAGVVL
Specifications

Specifications

integrin beta 1 binding protein (melusin) 2
Unconjugated
50% glycerol
NM_012278
CHORDC3|ITGB1BP|MELUSIN|MGC119214|MSTP015
Mouse
50 uL
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Primary
26548
ELISA, Western Blot
Mouse polyclonal antibody raised against a partial recombinant ITGB1BP2.
ITGB1BP2
Serum
ITGB1BP2
ITGB1BP2 (NP_036410, 246 a.a. ~ 319 a.a) partial recombinant protein with GST tag.
RUO
Y
Polyclonal
Human
Documents
Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit