anti-KIF22, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

Manufacturer:  Novus Biologicals NBP182876

Catalog No. NBP182876

Description

KIF22 Polyclonal antibody specifically detects KIF22 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.

Specifications

• Antigen: KIF22
• Conjugate: Unconjugated
• Formulation: PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
• Gene Alias: Kid, KIDA-328A3.2, kinesin family member 22, kinesin-like 4, Kinesin-like DNA-binding protein, Kinesin-like protein 4, kinesin-like protein KIF22, KNSL4kinesin-like DNA-binding protein pseudogene, OBP, OBP-1, OBP-2, origin of plasmid DNA replication-binding protein, oriP binding protein
• Host Species: Rabbit
• Isotype: IgG
• Quantity: 0.1 ml
• Research Discipline: Core ESC Like Genes, Stem Cell Markers
• Primary or Secondary: Primary
• Gene ID (Entrez): 3835
• Target Species: Human

• Applications: Immunohistochemistry, Immunohistochemistry (Paraffin), Western Blot
• Dilution: Western Blot 0.4 ug/ml, Immunohistochemistry 1:1000 - 1:2500, Immunohistochemistry-Paraffin 1:1000 - 1:2500
• Format: Affinity Purified
• Gene Symbols: KIF22
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids:SLGGSAHSILIANIAPERRFYLDTVSALNFAARSKEVINRPFTNESLQPHALGPVKLSQKELLGPPEAKRARG
• Purification Method: Immunogen affinity purified
• Regulatory Status: RUO
• Storage Requirements: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Monoclonal or Polyclonal: Polyclonal
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.

For Research Use Only