Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
anti-kle-2, Polyclonal, Novus Biologicals
Rabbit Polyclonal Antibody
Manufacturer: Novus Biologicals 48530002
Description
kle-2 Polyclonal antibody specifically detects kle-2 in C. elegans samples. It is validated for Western Blot, ELISA.Specifications
kle-2 | |
1 mg/mL | |
Western Blot 1:100-1:2000, ELISA 1:100-1:2000 | |
P34341 | |
KLE2, kle-2 Protein KLE-2 | |
Rabbit | |
IgG | |
Immunogen affinity purified | |
RUO | |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. | |
Polyclonal | |
Caenorhabditis elegans. |
ELISA, Western Blot | |
Unconjugated | |
20mM Potassium Phosphate (pH 7.0) and 0.15M NaCl with No Preservative | |
Affinity Purified | |
KLE2 | |
In vivo generated recominant protein fragment: MTRNAPPGQESTDLAWLVTPAKDLVENFSIDVLKALAGYLEVIRQESEDTDNQVDAATTYRLFDFQRACRIIQGSCAVYGRKVDHVYELTISVVDLVENK | |
95 kDa | |
0.05 mg | |
modENCODE Antibodies | |
Primary | |
176116 | |
C. elegans |
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title
For Research Use Only