kallikrein-related peptidase 14, Mouse, Polyclonal Antibody, Abnova™

Mouse polyclonal antibody raised against a full-length human KLK14 protein.

Manufacturer:  Abnova Corporation H00043847B01

Catalog No. 89-007-542

Description

Kallikreins are a subgroup of serine proteases having diverse physiological functions. Growing evidence suggests that many kallikreins are implicated in carcinogenesis and some have potential as novel cancer and other disease biomarkers. This gene is one of the fifteen kallikrein subfamily members located in a cluster on chromosome 19. An additional transcript variant has been described but its full length nature has not been determined. [provided by RefSeq

Sequence: MFLLLTALQVLAIAMTQSQEDENKIIGGHTCTRSSQPWQAALLAGPRRRFLCGGALLSGQWVITAAHCGRPILQVALGKHNLRRWEATQQVLRVVRQVTHPNYNSRTHDNDLMLLQLQQPARIGRAVRPIEVTQACASPGTSCRVSGWGTISSPIARYPASLQCVNINISPDEVCQKAYPRTITPGMVCAGVPQGGKDSCQGDSGGPLVCRGQLQGLVSWGMERCALPGYPGVYTNLCKYRSWIEETMRDK

Specifications

• Antigen: kallikrein-related peptidase 14
• Conjugate: Unconjugated
• Formulation: No additive
• Gene Accession No.: ENST00000156499
• Gene Alias: KLK-L6
• Host Species: Mouse
• Quantity: 50 uL
• Storage Requirements: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Primary or Secondary: Primary
• Gene ID (Entrez): 43847

• Applications: Western Blot
• Description: Mouse polyclonal antibody raised against a full-length human KLK14 protein.
• Gene: KLK14
• Format: Serum
• Gene Symbols: KLK14
• Immunogen: KLK14 (ENSP00000156499, 1 a.a. ~ 251 a.a) full-length human protein.
• Regulatory Status: RUO
• Whole Molecule: Y
• Monoclonal or Polyclonal: Polyclonal
• Target Species: Human