Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

kallikrein-related peptidase 14, Mouse, Polyclonal Antibody, Abnova™

Mouse polyclonal antibody raised against a full-length human KLK14 protein.

Manufacturer:  Abnova Corporation H00043847B01

Catalog No. 89-007-542


Add to cart

Description

Description

Kallikreins are a subgroup of serine proteases having diverse physiological functions. Growing evidence suggests that many kallikreins are implicated in carcinogenesis and some have potential as novel cancer and other disease biomarkers. This gene is one of the fifteen kallikrein subfamily members located in a cluster on chromosome 19. An additional transcript variant has been described but its full length nature has not been determined. [provided by RefSeq

Sequence: MFLLLTALQVLAIAMTQSQEDENKIIGGHTCTRSSQPWQAALLAGPRRRFLCGGALLSGQWVITAAHCGRPILQVALGKHNLRRWEATQQVLRVVRQVTHPNYNSRTHDNDLMLLQLQQPARIGRAVRPIEVTQACASPGTSCRVSGWGTISSPIARYPASLQCVNINISPDEVCQKAYPRTITPGMVCAGVPQGGKDSCQGDSGGPLVCRGQLQGLVSWGMERCALPGYPGVYTNLCKYRSWIEETMRDK
Specifications

Specifications

kallikrein-related peptidase 14
Unconjugated
No additive
ENST00000156499
KLK-L6
Mouse
50 uL
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Primary
43847
Western Blot
Mouse polyclonal antibody raised against a full-length human KLK14 protein.
KLK14
Serum
KLK14
KLK14 (ENSP00000156499, 1 a.a. ~ 251 a.a) full-length human protein.
RUO
Y
Polyclonal
Human
SDS
Documents
Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit