Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

anti-Klotho, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

Manufacturer:  Novus Biologicals NBP155097

Catalog No. NBP155097


Add to cart

Description

Description

Klotho Polyclonal antibody specifically detects Klotho in Human samples. It is validated for Western Blot.
Specifications

Specifications

Klotho
Unconjugated
PBS & 2% Sucrose. with 0.09% Sodium Azide
Affinity Purified
KL
Synthetic peptides corresponding to KL(klotho) The peptide sequence was selected from the n terminal of KL (BAA24941). Peptide sequence FPDGFLWAVGSAAYQTEGGWQQHGKGASIWDTFTHHPLAPPGDSRNASLP.
60 kDa
100 ul
Store at -20C. Avoid freeze-thaw cycles.
Polyclonal
Recognizes Klotho isoform 2 (62 kDa band observed).
Human
Western Blot
Western Blot 0.2-1 ug/ml
Q9UEF7
EC 3.2.1, EC 3.2.1.31, klotho
Rabbit
IgG
Immunogen affinity purified
RUO
Primary
9365
Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
Documents
Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit

For Research Use Only