Kv10.2 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody has been used in 1 publication

Supplier:  Novus Biologicals NBP184934

Catalog No. NBP184934

Description

Kv10.2 Polyclonal specifically detects Kv10.2 in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry-Paraffin.

Specifications

• Antigen: Kv10.2
• Classification: Polyclonal
• Dilution: Immunohistochemistry, Immunohistochemistry-Paraffin 1:50 - 1:200
• Gene Alias: hEAG2, potassium channel HEAG2, potassium voltage-gated channel, subfamily H (eag-related), member 5, voltage-gated potassium channel subunit Kv10.2
• Host Species: Rabbit
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
• Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

• Applications: Immunohistochemistry, Immunohistochemistry (Paraffin)
• Conjugate: Unconjugated
• Formulation: PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
• Gene Symbols: KCNH5
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids:GDYEVIDEVTNTIQIDSWLYQLALSIGTPYRYNTSAGIWEGGPSKDS
• Quantity: 0.1 mL
• Research Discipline: Apoptosis, Cancer, DNA Double Strand Break Repair, Protein Phosphatase, Signal Transduction, Tumor Suppressors
• Gene ID (Entrez): 27133
• Target Species: Human
• Isotype: IgG

For Research Use Only