Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
anti-LARP7, Polyclonal, Novus Biologicals
Rabbit Polyclonal Antibody
Manufacturer: Novus Biologicals NBP185083
Description
LARP7 Polyclonal antibody specifically detects LARP7 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.Specifications
LARP7 | |
Unconjugated | |
PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide | |
DKFZp564K112, HDCMA18P, La ribonucleoprotein domain family member 7, La ribonucleoprotein domain family, member 7, la-related protein 7, PIP7SMGC104360, P-TEFb-interaction protein for 7SK stability | |
Rabbit | |
IgG | |
0.1 ml | |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. | |
Polyclonal | |
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
Immunohistochemistry, Immunohistochemistry (Paraffin), Western Blot | |
Western Blot 0.4 ug/ml, Immunohistochemistry, Immunohistochemistry-Paraffin 1:20 - 1:50 | |
Affinity Purified | |
LARP7 | |
This antibody was developed against Recombinant Protein corresponding to amino acids:DSGVPQNTGMKNEKTANREECRTQEKVNATGPQFVSGVIVKIISTEPLPGRKQVRDTLAAISEVLYVDLLEGDTECHA | |
Immunogen affinity purified | |
RUO | |
Primary | |
51574 | |
Human |
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title
For Research Use Only