Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

protein kinase-like protein SgK493, Mouse, Polyclonal Antibody, Abnova™

Mouse polyclonal antibody raised against a full-length human LOC91461 protein.

Manufacturer:  Abnova Corporation H00091461B01

Catalog No. 89-008-417



Description

Description

Sequence: MVLLERLRHPNVLQLYGYCYQDSEDIPDTLTTITELGAPVEMIQLLQTSWEDRFRICLSLGRLLHHLAHSPLGSVTLLDFRPRQFVLVDGELKVTDLDDARVEETPCAGSTDCILEFPARNFTLPCSAQGWCEGMNEKRNLYNAYRFFFTYLLPHSAPPSLRPLLDSIVNATGELAWGVDETLAQLEKVLHLYRSGQYLQNSTASSSTEYQCIPDSTIPQEDYRCWPSYHHGSCLLSVFNLAEAVDVCESHAQCRAFVVTNQTTWTGRQLVFFKTGWSQVVPDPNKTTYVKASG
Specifications

Specifications

protein kinase-like protein SgK493
Polyclonal
Mouse polyclonal antibody raised against a full-length human LOC91461 protein.
SGK493
FLJ18197/MGC125960
Mouse
50 μL
Kinases
Primary
Human
Western Blot
Unconjugated
No additive
NM_138370.1
SGK493
LOC91461 (NP_612379.1, 1 a.a. ∼ 294 a.a) full-length human protein.
RUO
Yes
91461
Serum
Safety and Handling

Safety and Handling

SDS
Documents
Product Certifications
Promotions

Promotions

Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit