Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

LRP8, Mouse, Clone: 1A1, Abnova™

Mouse monoclonal antibody raised against a partial recombinant LRP8.

Manufacturer:  Abnova Corporation H00007804M02

Catalog No. 89-002-723


Add to cart

Description

Description

This gene encodes an apolipoprotein E receptor, a member of the low density lipoprotein receptor (LDLR) family. Apolipoprotein E is a small lipophilic plasma protein and a component of lipoproteins such as chylomicron remnants, very low density lipoprotein (VLDL), and high density lipoprotein (HDL). The apolipoprotein E receptor is involved in cellular recognition and internalization of these lipoproteins. Alternative splicing generates multiple transcript variants encoding distinct isoforms for this gene. [provided by RefSeq

Sequence: KKTCADSDFTCDNGHCIHERWKCDGEEECPDGSDESEATCTKQVCPAEKLSCGPTSHKCVPASWRCDGEKDCEGGADEAGCATLCAPH
Specifications

Specifications

LRP8,
1A1
Mouse monoclonal antibody raised against a partial recombinant LRP8.
LRP8
Liquid
LRP8
LRP8 (NP_004622, 83 a.a. ~ 170 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
100 ug
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Monoclonal
Human
ELISA, Western Blot
Unconjugated
In 1X PBS, pH 7.4
NM_004631
APOER2|HSZ75190|MCI1
Mouse
IgG1 Kappa
RUO
Primary
7804
Documents
Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit