Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

lymphocyte antigen 96, Mouse, Polyclonal Antibody, Abnova™

Mouse polyclonal antibody raised against a full-length human LY96 protein.

Manufacturer:  Abnova Corporation H00023643B01

Catalog No. 89-007-321


Add to cart

Description

Description

The MD-2 protein appears to associate with toll-like receptor 4 on the cell surface and confers responsiveness to lipopolysaccyaride (LPS), thus providing a link between the receptor and LPS signaling. [provided by RefSeq

Sequence: MLPFLFFSTLFSSIFTEAQKQYWVCNSSDASISYTYCDKMQYPISINVNPCIELKGSKGLLHIFYIPRRDLKQLYFNLYITVNTMNLPKRKEVICRGSDDDYSFCRALKGETVNTTISFSFKGIKFSKGKYKCVVEAISGSPEEMLFCLEFVILHQPNSN
Specifications

Specifications

lymphocyte antigen 96
Unconjugated
No additive
NM_015364
MD-2|MD2
Mouse
50 uL
Signal Transduction
Y
Polyclonal
Human
Western Blot
Mouse polyclonal antibody raised against a full-length human LY96 protein.
LY96
Serum
LY96
LY96 (NP_056179, 1 a.a. ~ 160 a.a) full-length human protein.
RUO
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Primary
23643
SDS
Documents
Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit