Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

MilliporeSigma™ anti-MAP Kinase 1/2 (Erk1/2), CT, Polyclonal Non-distribution product as customer accommodation.

Manufacturer:  MilliporeSigma™ 06182/DEL

Catalog No. 50-172-005

This item has been discontinued and is no longer available. Please call customer service for assistance: 1-800-766-7000.


Description

Description

The extracellular signal-regulated kinases 1 and 2 (ERK1 and ERK2), also called p44 and p42 MAP kinases, are members of the Mitogen Activated Protein Kinase (MAPK) family of proteins found in all eukaryotes. Because the 44kDa ERK1 and the 42kDa ERK2 are highly homologous and both function in the same protein kinase cascade, the two proteins are often referred to collectively as ERK1/2 or p44/p42 MAP kinase. The ERK1/2 signaling cascade has been shown to be a critical regulator of cell differentiation, cell physiology and neuronal function. Aberrant control of ERK1/2 activity has been implicated in a variety of pathological conditions, including cancer and autoimmune diseases, and efficient study methods are in demand. GenBank Number: NM_053842, NM_017347. MW: MAPK1/Erk1 (44kDa) and MAPK2/Erk2 (42kDa).

Immunocytochemistry, Immunoprecipitation, Western Blotting

Abbreviations: AP=Affinity Purification, ChIP=Chromatin IP, CM=Confocal Microscopy, DB=Dot Blot, EIA=ELISA, EM=Electron Microscopy, FC=Flow Cytometry, GS=Gel Supershift, IC=Immunocytochemistry, IF=Immunofluorescence, IH=Immunohistology/Immunohistochemistry, IP=Immunoprecipitation, IPK=IP Kinase Assay, KA=Kinase Assay, NEUT=Neutralization, PIA=Peptide Inhibition Assay, RIA=Radioimmunossay, TCA=T Cell Activation, WB=Western Blotting, Species: Am=Amphibian, Av=Avian, B=Bovine, Ca=Cat ,Ck=Chicken, D=Dog, Dr=Deer, Ds=Drosophila, El=Elk, Fg=Frog, Fs=Fish, Ft=Ferret, G=Goat, Gp=Guinea Pig, H=Horse, Hm=Hamster, Hu=Human, K=Kangaroo, Ms=Mouse, Nhp=Non-Human Primate, O=Ovine, P=Porcine, Rb=Rabbit, Rp=Reptile, Rt=Rat, Ys=Yeast, Xn=Xenopus, (wk)=cross reacts weakly

Specifications

Specifications

MAP Kinase 1/2 (Erk1/2), CT
Affinity Purified
38-residue synthetic peptide (CGGPFTFDMELDDLPKERLKELIFQETARFQPGAPEAP) corresponding to the C-terminal 35 amino acids of the rat 44kDa MAP Kinase 2/Erk2
100μg
Cell Signaling
Polyclonal
Unconjugated
Rabbit
IgG
RUO
Primary
Avian, Echinodermata, Human, Murine, Rat, Sheep, Xenopus
Documents
Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit