Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

mitogen-activated protein kinase 12, Mouse, Polyclonal Antibody, Abnova™

Mouse polyclonal antibody raised against a full-length human MAPK12 protein.

Manufacturer:  Abnova Corporation H00006300B01

Catalog No. 89-006-193


Add to cart

Description

Description

Activation of members of the mitogen-activated protein kinase family is a major mechanism for transduction of extracellular signals. Stress-activated protein kinases are one subclass of MAP kinases. The protein encoded by this gene functions as a signal transducer during differentiation of myoblasts to myotubes. [provided by RefSeq

Sequence: MSSPPPARSGFYRQEVTKTAWEVRAVYRDLQPVGSGAYGAVCSAVDGRTGAKVAIKKLYRPFQSELFAKRAYRELRLLKHMRHENVIGLLDVFTPDETLDDFTDFYLVMPFMGTDLGKLMKHEKLGEDRIQFLVYQMLKGLRYIHAAGIIHRDLKPGNLAVNEDCELKILDFGLARQADSEMTGYVVTRWYRAPEVILNWMRYTQTVDIWSVGCIMAEMITGKTLFKGSDHLDQLKEIMKVTGTPPAEFVQRLQSDEAKNYMKGLPELEKKDFASILTNASPLAVNLLEKMLVLDAEQRVTAGEALAHPYFESLHDTEDEPQVQKYDDSFDDVDRTLDEWKRVTYKEVLSFKPPRQLGARVSKETPL
Specifications

Specifications

mitogen-activated protein kinase 12
Unconjugated
No additive
NM_002969.3
ERK3|ERK6|P38GAMMA|PRKM12|SAPK-3|SAPK3
Mouse
50 uL
Cell Cycle
Y
Polyclonal
Human
Western Blot
Mouse polyclonal antibody raised against a full-length human MAPK12 protein.
MAPK12
Serum
MAPK12
MAPK12 (NP_002960.2, 1 a.a. ~ 367 a.a) full-length human protein.
RUO
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Primary
6300
Documents
Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit