MARCH4 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP191639

Catalog No. NBP191639

Description

44259 Polyclonal specifically detects 44259 in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry-Paraffin.

Specifications

• Antigen: MARCH4
• Classification: Polyclonal
• Dilution: Immunohistochemistry 1:50 - 1:200, Immunohistochemistry-Paraffin 1:50 - 1:200
• Gene Accession No.: Q9P2E8
• Gene Symbols: 43163
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids:WKVLNYDKTKDLEDQKAGGRTNPRTSSSTQANIPSSEEETAGTPAPEQGPAQAAGHPSGPLSHHHCAYTILHILSHLRPHEQRSP
• Quantity: 0.1 mL
• Research Discipline: Zinc Finger
• Gene ID (Entrez): 57574
• Target Species: Human
• Isotype: IgG

• Applications: Immunohistochemistry, Immunohistochemistry (Paraffin)
• Conjugate: Unconjugated
• Formulation: PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
• Gene Alias: EC 6.3.2.-, KIAA1399E3 ubiquitin-protein ligase MARCH4, MARCH-IVMGC104908, membrane-associated ring finger (C3HC4) 4, Membrane-associated RING finger protein 4, Membrane-associated RING-CH protein IV, RNF174RING finger protein 174
• Host Species: Rabbit
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
• Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

For Research Use Only