Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

enolase-phosphatase 1, Mouse, Polyclonal Antibody, Abnova™

Mouse polyclonal antibody raised against a full-length human MASA protein.

Manufacturer:  Abnova Corporation H00058478B01

Catalog No. 89-008-014


Add to cart

Description

Description

Sequence: MVVLSVPAEVTVILLDIEGTTTPIAFVKDILFPYIEENVKEYLQTHWEEEECQQDVSLLRKQAEEDAHLDGAVPIPAASGNGVDDLQQMIQAVVDNVCWQMSLDRKTTALKQLQGHMWRAAFTAGRMKAEFFADVVPAVRKWREAGMKVYIYSSGSVEAQKLLFGHSTEGDILELVDGHFDTKIGHKVESESYRKIADSIGCSTNNILFLTDVTREASAAEEADVHVAVVVRPGNAGLTDDEKTYYSLITSFSELYLPSST
Specifications

Specifications

enolase-phosphatase 1
Unconjugated
No additive
NM_021204
DKFZp586M0524|E1|FLJ12594|MASA|MST145
Mouse
50 uL
Stem Cell Biology
Y
Polyclonal
Human
Western Blot
Mouse polyclonal antibody raised against a full-length human MASA protein.
ENOPH1
Serum
ENOPH1
MASA (NP_067027, 1 a.a. ~ 261 a.a) full-length human protein.
RUO
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Primary
58478
SDS
Documents
Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit