MBNL2 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP179451

Catalog No. NBP179451

Description

MBNL2 Polyclonal specifically detects MBNL2 in Human samples. It is validated for Western Blot.

Specifications

• Antigen: MBNL2
• Classification: Polyclonal
• Conjugate: Unconjugated
• Formulation: PBS, 2% Sucrose with 0.09% Sodium Azide
• Gene Symbols: MBNL2
• Immunogen: Synthetic peptide directed towards the middle region of human MBNL2The immunogen for this antibody is MBNL2. Peptide sequence ENGRVIACFDSLKGRCSRENCKYLHPPTHLKTQLEINGRNNLIQQKTAAA.
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Gene ID (Entrez): 10150
• Target Species: Human, Mouse, Rat, Bovine, Canine, Equine, Guinea Pig, Rabbit, Zebrafish
• Isotype: IgG

• Applications: Western Blot
• Concentration: 0.5 mg/ml
• Dilution: Western Blot 1.0 ug/ml
• Gene Alias: DKFZp781H1296, MBLL39Muscleblind-like protein 1, MBLLMGC120628, MGC120625, MGC120626, MLP1, muscleblind-like 2 (Drosophila), muscleblind-like protein 2, Muscleblind-like protein-like, Muscleblind-like protein-like 39, PRO2032
• Host Species: Rabbit
• Molecular Weight of Antigen: 28 kDa
• Quantity: 100 μL
• Primary or Secondary: Primary
• Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

For Research Use Only