Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Our pricing system is unavailable. You are viewing list price.
Please call 1-800-766-7000 to place your order or try our site again later.

MBNL2 Rabbit anti-Human, Mouse, Rat, Bovine, Canine, Equine, Guinea Pig, Rabbit, Zebrafish, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

Manufacturer:  Novus Biologicals NBP179451

Catalog No. NBP179451



Description

Description

MBNL2 Polyclonal antibody specifically detects MBNL2 in Human, Mouse, Rat, Bovine, Canine, Equine, Guinea Pig, Rabbit, Zebrafish samples. It is validated for Western Blot.
Specifications

Specifications

MBNL2
Unconjugated
PBS and 2% Sucrose with 0.09% Sodium Azide
DKFZp781H1296, MBLL39Muscleblind-like protein 1, MBLLMGC120628, MGC120625, MGC120626, MLP1, muscleblind-like 2 (Drosophila), muscleblind-like protein 2, Muscleblind-like protein-like, Muscleblind-like protein-like 39, PRO2032
Rabbit
IgG
Immunogen affinity purified
RUO
Primary
10150
Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Rabbit, Rat, Zebrafish
Western Blot
Western Blot 1:1000
Affinity Purified
MBNL2
Synthetic peptide directed towards the middle region of human MBNL2The immunogen for this antibody is MBNL2. Peptide sequence ENGRVIACFDSLKGRCSRENCKYLHPPTHLKTQLEINGRNNLIQQKTAAA.
28 kDa
100 ul
Store at -20C. Avoid freeze-thaw cycles.
Polyclonal
Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
Documents
Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit

For Research Use Only