Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

MDH2 Rabbit anti-Human, Mouse, Rat, Bovine, Canine, Equine, Guinea Pig, Rabbit, Zebrafish, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

Manufacturer:  Novus Biologicals NBP154649

Catalog No. NBP154649


Add to cart

Description

Description

MDH2 Polyclonal antibody specifically detects MDH2 in Human, Mouse, Rat, Bovine, Canine, Equine, Guinea Pig, Rabbit, Zebrafish samples. It is validated for Western Blot, Immunohistochemistry.
Specifications

Specifications

MDH2
Unconjugated
PBS and 2% Sucrose with 0.09% Sodium Azide
Purified
MDH2
Synthetic peptides corresponding to MDH2(malate dehydrogenase 2, NAD (mitochondrial)) The peptide sequence was selected from the C terminal of MDH2 (NP_005909). Peptide sequence TYFSTPLLLGKKGIEKNLGIGKVSSFEEKMISDAIPELKASIKKGEDFVK.
33 kDa
100ul
Store at -20C. Avoid freeze-thaw cycles.
Polyclonal
Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 100μL of distilled water. Vortex followed by.
Immunohistochemistry, Western Blot
Western Blot 2.5 ug/ml, Immunohistochemistry
P40926
EC 1.1.1, EC 1.1.1.37, malate dehydrogenase 2, NAD (mitochondrial), MDH, MGC:3559, mitochondrial, MOR1
Rabbit
IgG
Protein A purified
RUO
Primary
4191
Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Rabbit, Rat, Zebrafish
Documents
Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit

For Research Use Only