Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

midkine (neurite growth-promoting factor 2), Mouse, Polyclonal Antibody, Abnova™

Mouse polyclonal antibody raised against a full-length human MDK protein.

Manufacturer:  Abnova Corporation H00004192B01

Catalog No. 89-005-739


Add to cart

Description

Description

Sequence: MQHRGFLLLTLLALLALTSAVAKKKDKVKKGGPGSECAEWAWGPCAPSSKDCGVGFREGTCGAQTQRIRCRVPCNWKKEFGADCKYKFENWGACDGGTGTKVRQGTLKKARYNAQCQETIRVTKPCTPKTKAKAKAKKGKGKD
Specifications

Specifications

midkine (neurite growth-promoting factor 2)
Unconjugated
No additive
BC011704
FLJ27379|MK|NEGF2
Mouse
50 uL
Cell Cycle
Y
Polyclonal
Human
Western Blot
Mouse polyclonal antibody raised against a full-length human MDK protein.
MDK
Serum
MDK
MDK (AAH11704, 1 a.a. ~ 143 a.a) full-length human protein.
RUO
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Primary
4192
Documents
Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit