Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

Melusin/ITGB1BP2 Rabbit anti-Human, Mouse, Rat, Porcine, Bovine, Canine, Equine, Guinea Pig, Rabbit, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

Manufacturer:  Novus Biologicals NBP155149

Catalog No. NBP155149


Add to cart

Description

Description

Melusin/ITGB1BP2 Polyclonal antibody specifically detects Melusin/ITGB1BP2 in Human, Mouse, Rat, Porcine, Bovine, Canine, Equine, Guinea Pig, Rabbit samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin).
Specifications

Specifications

Melusin/ITGB1BP2
Unconjugated
PBS and 2% Sucrose with 0.09% Sodium Azide
Purified
ITGB1BP2
Synthetic peptides corresponding to ITGB1BP2(integrin beta 1 binding protein (melusin) 2) The peptide sequence was selected from the N terminal of ITGB1BP2. Peptide sequence MSLLCRNKGCGQHFDPNTNLPDSCCHHPGVPIFHDALKGWSCCRKRTVDF.
38 kDa
100ul
Cancer, Cytokine Research, Cytoskeleton Markers, Embryonic Stem Cell Markers, Immunology, Mesenchymal Stem Cell Markers, Neuronal Cell Markers, Neuronal Stem Cell Markers, Signal Transduction, Stem Cell Markers
Primary
26548
Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 100μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
Immunohistochemistry, Immunohistochemistry (Paraffin), Western Blot
Western Blot 1:100-1:2000, Immunohistochemistry 1:10-1:500, Immunohistochemistry-Paraffin 1:10-1:500
Q9UKP3
CHORDC3, integrin beta 1 binding protein (melusin) 2, integrin beta-1-binding protein 2, ITGB1BP, Melusin, MGC119214
Rabbit
IgG
Protein A purified
RUO
Store at -20C. Avoid freeze-thaw cycles.
Polyclonal
Guinea pig: 86%.
Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Porcine, Rabbit, Rat
Documents
Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit

For Research Use Only