Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

coiled-coil domain containing 83, Mouse, Polyclonal Antibody, Abnova™

Mouse polyclonal antibody raised against a partial recombinant MGC34732.

Manufacturer:  Abnova Corporation H00220047A01

Catalog No. 89-004-817


  Check Availability
Add to cart

Specifications

Description

Sequence: SSDESTILHLSHENSIEDLQYVKIDKEENSGTEFGDTDMKYLLYEDEKDFKDYVNLGPLGVKLMSVESKKMPIHFQEKEIPVKLYKDVRSPESHITYKMMKSFL
Description & Specifications

Specifications

coiled-coil domain containing 83
Unlabeled
50% glycerol
NM_173556
FLJ42119, HSD9, MGC34732
Murine
50μL
Kinases
Y
Polyclonal
Human
Western Blot
coiled-coil domain containing 83
CCDC83
Serum
CCDC83
MGC34732 (NP_775827, 341 a.a. ∽445 a.a) partial recombinant protein with GST tag.
RUO
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Primary
220047
Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit