coiled-coil domain containing 83, Mouse, Polyclonal Antibody, Abnova™

Mouse polyclonal antibody raised against a partial recombinant MGC34732.

Manufacturer: Abnova Corporation H00220047A01

Catalog No. 89-004-817

  Check Availability
Add to Cart

    Specifications

    Gene Accession No. NM_173556
    Gene CCDC83
    Gene Alias FLJ42119, HSD9, MGC34732
    Gene Symbols CCDC83
    Species Reactivity Human
    Gene ID (Entrez) 220047
    Formulation 50% glycerol
    Applications Western Blotting
    Storage Requirements Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
    Description coiled-coil domain containing 83
    Research Discipline Kinases
    Antigen coiled-coil domain containing 83
    Cross Reactivity Human
    Primary or Secondary Primary
    Conjugate Unlabeled
    Immunogen MGC34732 (NP_775827, 341 a.a. ∽445 a.a) partial recombinant protein with GST tag.
    Quantity 50μL
    Regulatory Status RUO
    Whole Molecule Y
    Monoclonal or Polyclonal Polyclonal
    Format Serum
    Host Species Mouse

    Sequence: SSDESTILHLSHENSIEDLQYVKIDKEENSGTEFGDTDMKYLLYEDEKDFKDYVNLGPLGVKLMSVESKKMPIHFQEKEIPVKLYKDVRSPESHITYKMMKSFL

  • Description & Specifications

Related Products


Product Content Feedback

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit