Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

magnesium-dependent phosphatase 1, Mouse, Polyclonal Antibody, Abnova™

Mouse polyclonal antibody raised against a full-length human MGC5987 protein.

Manufacturer:  Abnova Corporation H00145553B01

Catalog No. 89-008-583


Add to cart

Description

Description

Sequence: MARLPKLAVFDLDYTLWPFWVDTHVDPPFHKSSDGTVRDRRGQDVRLYPEVPEVLKRLQSLGVPGAAASRTSEIEGANQLLELFDLFRYFVHREIYPGSKITHFERLQQKTGIPFSQMIFFDDERRNIVDVSKLGVTCIHIQNGMNLQTLSQGLETFAKAQTGPLRSSLEESPFEA
Specifications

Specifications

magnesium-dependent phosphatase 1
Unconjugated
No additive
NM_138476.2
MGC5987
Mouse
50 uL
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Primary
145553
Immunofluorescence, Western Blot
Mouse polyclonal antibody raised against a full-length human MGC5987 protein.
MDP-1
Serum
MDP-1
MGC5987 (NP_612485.2, 1 a.a. ~ 176 a.a) full-length human protein.
RUO
Y
Polyclonal
Human
SDS
Documents
Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit