MINOS1 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP231802

Catalog No. NBP231802

Description

MINOS1 Polyclonal specifically detects MINOS1 in Human samples. It is validated for Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin.

Specifications

• Antigen: MINOS1
• Classification: Polyclonal
• Dilution: Immunohistochemistry 1:500-1:1000, Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml, Immunohistochemistry-Paraffin 1:500 - 1:1000
• Gene Accession No.: Q5TGZ0
• Gene Symbols: MINOS1
• Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: RMWPLAFGSGMGLGMAYSNCQHDFQAPYLLHGKYVKEQE
• Quantity: 0.1 mL
• Primary or Secondary: Primary
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
• Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

• Applications: Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin)
• Conjugate: Unconjugated
• Formulation: PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
• Gene Alias: mitochondrial inner membrane organizing system 1
• Host Species: Rabbit
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Gene ID (Entrez): 440574
• Target Species: Human
• Isotype: IgG

For Research Use Only