Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

Mkl1 Rabbit anti-Human, Mouse, Rat, Porcine, Bovine, Canine, Equine, Rabbit, Zebrafish, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

Manufacturer:  Novus Biologicals NBP180259

Catalog No. NBP180259


Add to cart

Description

Description

Mkl1 Polyclonal antibody specifically detects Mkl1 in Human, Mouse, Rat, Porcine, Bovine, Canine, Equine, Rabbit, Zebrafish samples. It is validated for Western Blot.
Specifications

Specifications

Mkl1
Unconjugated
PBS and 2% Sucrose with 0.09% Sodium Azide
Purified
MRTFA
The immunogen is a synthetic peptide corresponding to a region of Mouse. Peptide sequence QPLSQPGFPAPGPPAQMDLEHPPQPPFATPTSLLKKEPPGYEETVTQQPK.
Protein A purified
RUO
Primary
57591
Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 100μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
Western Blot
Western Blot 1:1000
NP_694629
AMKL, KIAA1438, MALSAP and coiled-coil domain, megakaryoblastic leukemia (translocation) 1, Megakaryoblastic leukemia 1 protein, Megakaryocytic acute leukemia protein, MKL/myocardin-like protein 1, Myocardin-related transcription factor A, RNA-binding motif protein 15/megakaryoblastic leukemia-1 fusion protein
Rabbit
IgG
100 ul
Store at -20C. Avoid freeze-thaw cycles.
Polyclonal
Expected identity based on immunogen sequence: Mouse: 100%; Rat: 100%; Bovine: 85%; Canine: 85%; Equine: 85%; Pig: 85%; Rabbit: 85%; Human: 78%; Chicken: 76%.
Bovine, Canine, Equine, Human, Mouse, Porcine, Rabbit, Rat, Zebrafish
Documents
Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit

For Research Use Only