Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

anti-MLC1SA, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

Manufacturer:  Novus BiologicalsSupplier Diversity Partner NBP192124

Catalog No. NBP192124


Add to cart

Description

Description

MLC1SA Polyclonal antibody specifically detects MLC1SA in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin.
Specifications

Specifications

MLC1SA
Unconjugated
PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
MLC1sa, MLC1SAmyosin light chain 1, slow-twitch muscle A isoform, myosin alkali light chain 1 slow a, myosin light chain 1 slow a, Myosin light chain 1 slow-twitch muscle A isoform, myosin light chain 6B, myosin, light chain 6B, alkali, smooth muscle and non-muscle, myosin, light polypeptide 6B, alkali, smooth muscle and non-muscle, smooth muscle and non-muscle myosin alkali light chain 6B, Smooth muscle and nonmuscle myosin light chain alkali 6B
Rabbit
IgG
0.1 ml
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Polyclonal
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Western Blot, Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin)
Western Blot 0.4 ug/ml, Immunohistochemistry 1:20 - 1:50, Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml, Immunohistochemistry-Paraffin 1:20-1:50
Affinity Purified
MYL6B
This antibody was developed against Recombinant Protein corresponding to amino acids:APPAKTKAEPAVPQAPQKTQEPPVDLSKVVIEFNKDQLEEFKE
Immunogen affinity purified
RUO
Primary
140465
Human
Documents
Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit

For Research Use Only